PDB entry 1yjy

View 1yjy on RCSB PDB site
Description: K226M Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Serine
Class: transferase
Keywords: SHMT, Mutant, Catalysis, TRANSFERASE
Deposited on 2005-01-16, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SHMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yjya1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjyA (A:)
    mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
    yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
    ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
    akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthmtlrgprggmilcqe
    qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
    ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
    aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltdptsrsaagtmefea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjyA (A:)
    mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
    yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
    ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
    akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthmtlrgprggmilcqe
    qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
    ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
    aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd