PDB entry 1yjv

View 1yjv on RCSB PDB site
Description: Solution structure of the Cu(I) form of the sixth soluble domain of Menkes protein
Class: hydrolase
Keywords: metallochaperone, protein-protein interaction, copper(I), metal homeostasis, hydrolase
Deposited on 2005-01-15, released 2006-01-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04656 (1-72)
      • cloning artifact (0)
      • cloning artifact (73-74)
    Domains in SCOPe 2.08: d1yjva1, d1yjva2, d1yjva3
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yjvA (A:)
    mgdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiih
    tieslgfeaslvkie