PDB entry 1yjs

View 1yjs on RCSB PDB site
Description: K226Q Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Glycine
Class: transferase
Keywords: SHMT, Mutant, Catalysis, TRANSFERASE
Deposited on 2005-01-15, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SHMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yjsa1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjsA (A:)
    mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
    yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
    ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
    akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthqtlrgprggmilcqe
    qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
    ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
    aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltdptsrsaagtmefea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjsA (A:)
    mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
    yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
    ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
    akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthqtlrgprggmilcqe
    qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
    ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
    aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd