PDB entry 1yjq

View 1yjq on RCSB PDB site
Description: Crystal structure of ketopantoate reductase in complex with NADP+
Class: oxidoreductase
Keywords: ketopantoate, NADP+ dependent, pantothenate pathway, secondary alcohol dehydrogenase
Deposited on 2005-01-15, released 2005-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.162
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydropantoate 2-reductase
    Species: Escherichia coli
    Gene: panE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yjqa1, d1yjqa2
  • Heterogens: ACT, NAP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjqA (A:)
    mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
    latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
    aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklavn
    cvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidatae
    nissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkeseyerigtglp
    rpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjqA (A:)
    mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
    latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
    aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklavn
    cvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidatae
    nissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkeseye