PDB entry 1yjm

View 1yjm on RCSB PDB site
Description: Crystal structure of the FHA domain of mouse polynucleotide kinase in complex with an XRCC4-derived phosphopeptide.
Class: Transferase/DNA BINDING PROTEIN
Keywords: polynucleotide kinase, FHA domain, XRCC4 phosphopeptide, Transferase-DNA BINDING PROTEIN COMPLEX
Deposited on 2005-01-14, released 2005-03-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polynucleotide 5'-hydroxyl-kinase
    Species: Mus musculus [TaxId:10090]
    Gene: Pnk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yjma1
  • Chain 'B':
    Compound: Polynucleotide 5'-hydroxyl-kinase
    Species: Mus musculus [TaxId:10090]
    Gene: Pnk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yjmb_
  • Chain 'C':
    Compound: Polynucleotide 5'-hydroxyl-kinase
    Species: Mus musculus [TaxId:10090]
    Gene: Pnk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yjmc_
  • Chain 'E':
    Compound: 12-mer peptide from DNA-repair protein XRCC4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YJM
  • Chain 'F':
    Compound: 12-mer peptide from DNA-repair protein XRCC4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YJM
  • Chain 'G':
    Compound: 12-mer peptide from DNA-repair protein XRCC4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YJM
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yjmA (A:)
msqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesr
tvavkqlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

    Sequence, based on observed residues (ATOM records): (download) 
    >1yjmA (A:)
lgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtva
vkqlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1yjmB (B:)
msqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesr
tvavkqlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

    Sequence, based on observed residues (ATOM records): (download) 
    >1yjmB (B:)
srgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavk
qlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1yjmC (C:)
msqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesr
tvavkqlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

    Sequence, based on observed residues (ATOM records): (download) 
    >1yjmC (C:)
rgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavkq
lgvnpstvgvhelkpglsgslslgdvlylvnglypltlrwe

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.