PDB entry 1yjl

View 1yjl on RCSB PDB site
Description: Reduced Peptidylglycine alpha-Hydroxylating Monooxygenase in a new crystal form
Class: oxidoreductase
Keywords: monooxygenase, bioactive peptide activation, copper, ascorbate, oxidoreductase
Deposited on 2005-01-14, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14925 (0-305)
      • engineered (264)
    Domains in SCOPe 2.07: d1yjla1, d1yjla2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjlA (A:)
    tigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvhhm
    llfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvl
    qvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqy
    kmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdil
    aarcvftgegrteathiggtssdeicnlyimyymeakyalsfmtctknvapdmfrtipae
    anipip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjlA (A:)
    tigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprtvhhmllfg
    cnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvlqvhy
    gdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqykmyp
    mhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdilaarc
    vfticnlyimyymeakyalsfmtctknvapdmfrtipaeanipip