PDB entry 1yjk

View 1yjk on RCSB PDB site
Description: Reduced Peptidylglycine Alpha-Hydroxylating Monooxygenase (PHM) in a New Crystal Form
Class: oxidoreductase
Keywords: monooxygenase, bioactive peptide activation, copper, ascorbate, oxidoreductase
Deposited on 2005-01-14, released 2005-11-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus
    Gene: PAM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yjka1, d1yjka2
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjkA (A:)
    tigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvhhm
    llfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvl
    qvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqy
    kmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdil
    aarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfrtipae
    anipip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjkA (A:)
    tigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvhhm
    llfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvl
    qvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqy
    kmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdil
    aarcvftgegrteathigsdemcnlyimyymeakyalsfmtctknvapdmfrtipaeani
    pip