PDB entry 1yji

View 1yji on RCSB PDB site
Description: RDC-refined Solution NMR structure of reduced putidaredoxin
Class: electron transport
Keywords: ferredoxin, [2Fe-2S], redox, iron-sulfur, electron transfer, NMR, cytochrome P450cam
Deposited on 2005-01-14, released 2005-06-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida
    Gene: CAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yjia1
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yjiA (A:)
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw