PDB entry 1yjh

View 1yjh on RCSB PDB site
Description: Crystal Structure of Cimex Nitrophorin Ferrous NO Complex
Class: oxygen storage/transport
Keywords: ferrous heme; nitric oxide; beta sandwich; five-coordinate iron, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-01-14, released 2005-12-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius [TaxId:79782]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28738 (Start-281)
    Domains in SCOPe 2.06: d1yjha_
  • Heterogens: NO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjhA (A:)
    gsppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpac
    vknfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivt
    sftiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetna
    thakslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatps
    wtdralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjhA (A:)
    ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl