PDB entry 1yjf

View 1yjf on RCSB PDB site
Description: Cyclized post-translational product for S65A Y66S (GFPhal) green fluorescent protein variant
Class: luminescent protein
Keywords: MIO, chromophore, electrophile, histidine ammonia lyase, HAL, biosynthesis, design, LUMINESCENT PROTEIN
Deposited on 2005-01-14, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.145
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • GB AAA27721
      • chromophore (66)
      • engineered (99)
      • engineered (153)
      • engineered (163)
    Domains in SCOPe 2.07: d1yjfa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yjfA (A:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttfasgvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjfA (A:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    fasgvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith