PDB entry 1yjb

View 1yjb on RCSB PDB site
Description: subtilisin bpn' 8397+1 (e.c. 3.4.21.14) (mutant with met 50 replaced by phe, asn 76 replaced by asp, gly 169 replaced by ala, gln 206 replaced by cys, asn 218 replaced by ser and lys 256 replaced by tyr) (m50f, n76d, g169a, q206c, n218s, and k256y) in 35% dimethylformamide
Class: hydrolase (serine protease)
Keywords: hydrolase, sporulation, serine protease, zymogen, signal, hydrolase (serine protease)
Deposited on 1996-01-16, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin 8397+1
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: 8397+1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-274)
      • engineered (49)
      • engineered (75)
      • engineered (168)
      • engineered (205)
      • engineered (217)
      • engineered (255)
    Domains in SCOPe 2.07: d1yjba_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yjbA (A:)
    aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasfvpsetnpfqd
    nnshgthvagtvaaldnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd
    vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypakypsviavgav
    dssnqrasfssvgpeldvmapgvsicstlpgnkygaysgtsmasphvagaaalilskhpn
    wtntqvrsslentttylgdsfyygkglinvqaaaq