PDB entry 1yj8

View 1yj8 on RCSB PDB site
Description: Initial structural analysis of Plasmodium falciparum Glycerol-3-phosphate dehydrogenase
Class: oxidoreductase
Keywords: SGPP, Structural Genomics, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, OXIDOREDUCTASE
Deposited on 2005-01-13, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0780w
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yj8a1, d1yj8a2
  • Chain 'B':
    Compound: glycerol-3-phosphate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0780w
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yj8b1, d1yj8b2
  • Chain 'C':
    Compound: glycerol-3-phosphate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0780w
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yj8c1, d1yj8c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yj8A (A:)
    mahhhhhhmyrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwird
    efvngermvdiinnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvl
    asikesesikiashakaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvam
    enfseatiggndkdslviwqrvfdlpyfkincvnetieveicgalkniitlacgfcdgln
    lptnsksaiirnginemilfgkvffqkfnenillescgfadiitsflagrnakcsaefik
    stpkktweeleneilkgqklqgtvtlkyvyhmikeknmtnefplftvlhkisfenedpss
    llktfmnnkinqlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj8A (A:)
    yrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwirdefermvdii
    nnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvlasikeikiasha
    kaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvamenfseatiggndkds
    lviwqrvfdlpyfkincvnetieveicgalkniitlacgfcdglnlptnsksaiirngin
    emilfgkvffqkfnenillescgfadiitsflagrnakcsaefikstpkktweeleneil
    kgqklqgtvtlkyvyhmikeknmtnefplftvlhkisfenedpssllktfmnnkinq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yj8B (B:)
    mahhhhhhmyrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwird
    efvngermvdiinnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvl
    asikesesikiashakaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvam
    enfseatiggndkdslviwqrvfdlpyfkincvnetieveicgalkniitlacgfcdgln
    lptnsksaiirnginemilfgkvffqkfnenillescgfadiitsflagrnakcsaefik
    stpkktweeleneilkgqklqgtvtlkyvyhmikeknmtnefplftvlhkisfenedpss
    llktfmnnkinqlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj8B (B:)
    yrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwirdefermvdii
    nnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvlasikeikiasha
    kaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvamenfseatiggndkds
    lviwqrvfdlpyfkincvnetieveicgalkniitlacgfcdglnlptnsksaiirngin
    emilfgkvffqkfnenillescgfadiitsflagrnakcsaefikstpkktweeleneil
    kgqklqgtvtlkyvyhmikeknmtnefplftvlhkisfenedpssllktfmnnkinq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yj8C (C:)
    mahhhhhhmyrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwird
    efvngermvdiinnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvl
    asikesesikiashakaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvam
    enfseatiggndkdslviwqrvfdlpyfkincvnetieveicgalkniitlacgfcdgln
    lptnsksaiirnginemilfgkvffqkfnenillescgfadiitsflagrnakcsaefik
    stpkktweeleneilkgqklqgtvtlkyvyhmikeknmtnefplftvlhkisfenedpss
    llktfmnnkinqlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj8C (C:)
    yrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwirdefermvdii
    nnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvlasikeikiasha
    kaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvamenfseatiggndkds
    lviwqrvfdlpyfkincvnetieveicgalkniitlacgfcdglnlptnsksaiirngin
    emilfgkvffqkfnenillescgfadiitsflagrnakcsaefikstpkktweeleneil
    kgqklqgtvtlkyvyhmikeknmtnefplftvlhkisfenedpssllktfmnnkinq