PDB entry 1yj7

View 1yj7 on RCSB PDB site
Description: crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj
Deposited on 2005-01-13, released 2005-06-07
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: escJ
    Species: Escherichia coli [TaxId:562]
    Gene: EscJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VQD3 (1-End)
      • initiating methionine (0)
      • engineered (42-44)
  • Chain 'B':
    Compound: escJ
    Species: Escherichia coli [TaxId:562]
    Gene: EscJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VQD3 (1-End)
      • engineered (42-44)
  • Chain 'C':
    Compound: escJ
    Species: Escherichia coli [TaxId:562]
    Gene: EscJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VQD3 (1-End)
      • engineered (42-44)
  • Chain 'D':
    Compound: escJ
    Species: Escherichia coli [TaxId:562]
    Gene: EscJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VQD3 (1-170)
      • engineered (42-44)
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yj7A (A:)
    mkeqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfp
    kkkfadievifppsqlvaspsqenakinylkeqdierllskipgvidcsvslnvnnnesq
    pssaavlvisspevnlapsviqiknlvknsvddlklenisvviksssgqdg
    

    Sequence, based on observed residues (ATOM records):
    >1yj7A (A:)
    mkeqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfp
    kkkfadievifpspsqenakinylkeqdierllskipgvidcsvslnvssaavlvisspe
    vnlapsviqiknlvknsvddlklenisvviksss
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yj7B (B:)
    mkeqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfp
    kkkfadievifppsqlvaspsqenakinylkeqdierllskipgvidcsvslnvnnnesq
    pssaavlvisspevnlapsviqiknlvknsvddlklenisvviksssgqdg
    

    Sequence, based on observed residues (ATOM records):
    >1yj7B (B:)
    keqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfpk
    kkfadievifpspsqenakinylkeqdierllskipgvidcsvslnvpssaavlvisspe
    vnlapsviqiknlvknsvddlklenisvviksss
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yj7C (C:)
    mkeqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfp
    kkkfadievifppsqlvaspsqenakinylkeqdierllskipgvidcsvslnvnnnesq
    pssaavlvisspevnlapsviqiknlvknsvddlklenisvviksssgqdg
    

    Sequence, based on observed residues (ATOM records):
    >1yj7C (C:)
    keqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfpk
    kkfadievifpspsqenakinylkeqdierllskipgvidcsvslnvpssaavlvisspe
    vnlapsviqiknlvknsvddlklenisvvikss
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1yj7D (D:)
    mkeqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfp
    kkkfadievifppsqlvaspsqenakinylkeqdierllskipgvidcsvslnvnnnesq
    pssaavlvisspevnlapsviqiknlvknsvddlklenisvviksssgqdg
    

    Sequence, based on observed residues (ATOM records):
    >1yj7D (D:)
    keqlytgltekeanqmqalllsndvnvskemdksgnmtlsvaaadfvraitilnnngfpk
    kkfadievifpspsqenakinylkeqdierllskipgvidcsvslnvpssaavlvisspe
    vnlapsviqiknlvknsvddlklenisvviksssgqdg