PDB entry 1yj6

View 1yj6 on RCSB PDB site
Description: crystal structure of human glutathione S-transferase M1A-1A complexed with glutathionyl-zinc-trihydroxide
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, dimer, active site, zinc, coordination complex
Deposited on 2005-01-13, released 2005-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yj6a1, d1yj6a2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yj6b1, d1yj6b2
  • Chain 'C':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yj6c1, d1yj6c2
  • Heterogens: ZN, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yj6A (A:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj6A (A:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yj6B (B:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj6B (B:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yj6C (C:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj6C (C:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk