PDB entry 1yj4

View 1yj4 on RCSB PDB site
Description: Y305F Trichodiene Synthase
Class: lyase
Keywords: terpenoid cyclase fold, site-directed mutant, LYASE
Deposited on 2005-01-13, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.244
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides [TaxId:5514]
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513 (0-End)
      • engineered (304)
    Domains in SCOPe 2.08: d1yj4a_
  • Chain 'B':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides [TaxId:5514]
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513
      • engineered (304)
    Domains in SCOPe 2.08: d1yj4b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yj4A (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj4A (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yj4B (B:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj4B (B:)
    fpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpkrl
    qaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagreq
    ahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqflrr
    mnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqisl
    vknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlcdr
    rfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqla