PDB entry 1yj3

View 1yj3 on RCSB PDB site
Description: crystal structure analysis of product bound methionine aminopeptidase type 1c from mycobacterium tuberculosis
Deposited on 2005-01-13, released 2005-07-05
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: map, mapB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, K, MET, BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yj3A (A:)
    hhhhhhmpsrtalspgvlsptrpvpnwiarpeyvgkpaaqegsepwvqtpeviekmrvag
    riaagalaeagkavapgvttdeldriaheylvdngaypstlgykgfpkscctslnevich
    gipdstvitdgdivnidvtayiggvhgdtnatfpagdvadehrllvdrtreatmraintv
    kpgralsvigrviesyanrfgynvvrdftghgigttfhnglvvlhydqpavetimqpgmt
    ftiepminlgaldyeiwddgwtvvtkdrkwtaqfehtllvtdtgveiltcl
    

    Sequence, based on observed residues (ATOM records):
    >1yj3A (A:)
    rtalspgvlsptrpvpnwiarpeyvgkpaaqegsepwvqtpeviekmrvagriaagalae
    agkavapgvttdeldriaheylvdngaypstlgykgfpkscctslnevichgipdstvit
    dgdivnidvtayiggvhgdtnatfpagdvadehrllvdrtreatmraintvkpgralsvi
    grviesyanrfgynvvrdftghgigttfhnglvvlhydqpavetimqpgmtftiepminl
    galdyeiwddgwtvvtkdrkwtaqfehtllvtdtgveiltcl