PDB entry 1yix

View 1yix on RCSB PDB site
Description: Crystal structure of YCFH, TATD homolog from Escherichia coli K12, at 1.9 A resolution
Class: hydrolase
Keywords: YCFH, TIM barrel, deoxyribonuclease, Zinc ion, New York SGX Research Center for Structural Genomics, NYSGXRC, Structural Genomics, PSI, Protein Structure Initiative, HYDROLASE
Deposited on 2005-01-13, released 2005-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribonuclease ycfH
    Species: Escherichia coli [TaxId:83333]
    Gene: ycfH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37346 (0-264)
      • conflict (45)
    Domains in SCOPe 2.08: d1yixa1
  • Chain 'B':
    Compound: deoxyribonuclease ycfH
    Species: Escherichia coli [TaxId:83333]
    Gene: ycfH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37346 (0-264)
      • conflict (45)
    Domains in SCOPe 2.08: d1yixb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yixA (A:)
    mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv
    vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig
    relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv
    tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave
    elaqvttdnfarlfhidasrlqsir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yixB (B:)
    mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv
    vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig
    relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv
    tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave
    elaqvttdnfarlfhidasrlqsir