PDB entry 1yiw

View 1yiw on RCSB PDB site
Description: X-ray Crystal Structure of a Chemically Synthesized Ubiquitin
Class: structural protein
Keywords: Ubiquitin
Deposited on 2005-01-13, released 2005-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.173
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH14880 (0-End)
      • engineered (0)
    Domains in SCOP 1.75: d1yiwa1
  • Chain 'B':
    Compound: Ubiquitin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH14880 (0-End)
      • engineered (0)
    Domains in SCOP 1.75: d1yiwb1
  • Chain 'C':
    Compound: Ubiquitin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH14880 (0-End)
      • engineered (0)
    Domains in SCOP 1.75: d1yiwc1
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yiwA (A:)
    lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yiwA (A:)
    lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yiwB (B:)
    lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yiwB (B:)
    lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yiwC (C:)
    lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yiwC (C:)
    lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlr