PDB entry 1yiv

View 1yiv on RCSB PDB site
Description: Structure of myelin P2 protein from Equine spinal cord
Class: lipid transport
Keywords: P2 Protein, LIPID TRANSPORT
Deposited on 2005-01-13, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p2 protein
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yiva1
  • Heterogens: EPE, LDA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yivA (A:)
    snkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdvitirtesgfknt
    eisfklgqefdettadnrkakstvtlaagalnqvqkwngnettikrklvdgkmvveckma
    svvctriyekv