PDB entry 1yiu

View 1yiu on RCSB PDB site
Description: Itch E3 ubiquitin ligase WW3 domain
Class: ligase
Keywords: WW domain, LIGASE
Deposited on 2005-01-13, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Itchy E3 ubiquitin protein ligase
    Species: Mus musculus [TaxId:10090]
    Gene: Itch E3 WW3 domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C863 (3-36)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1yiua1, d1yiua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yiuA (A:)
    gamgplppgwekrtdsngrvyfvnhntritqwedprs