PDB entry 1yis

View 1yis on RCSB PDB site
Description: Structural genomics of Caenorhabditis elegans: adenylosuccinate lyase
Class: lyase
Keywords: Caenorhabditis; X-ray structure, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, LYASE
Deposited on 2005-01-12, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate lyase
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q21774
      • modified residue (60)
      • modified residue (84)
      • modified residue (176)
      • modified residue (188)
      • modified residue (294)
      • modified residue (334)
      • modified residue (381-383)
      • modified residue (420)
    Domains in SCOPe 2.07: d1yisa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yisA (A:)
    masedkfesvlstrycknsplvsilsetnkatlwrqlwiwlaeaekelglkqvtqdaide
    mksnrdvfdwpfirseerklkhdvmahnhafgklcptaagiihlgatscfvqdnadliay
    rdsidhilkrfatvidrlaafslknkevvtvgrthyqtaslvtvgkrgvlwaqellmafq
    slsefrdkmrfrgikgatgtqdsfltlfagdeskvealdelvtkkanfsnrflitgqtys
    rqqdsqlvfslsllgaaakkvctdirvlqafgellepfekdqigssampykknpmkserc
    calsrklinapqealtiladqglertlddsagrrmlipdvlltaeallttlqnifeglsv
    qtdnvkkivedeiaflglekammmlteegvdrqqahavirktaleakqlqatqkvdirqt
    madpffdsvrdrvvglvnnpinftgrcvsqtesfiakelkptidkyldksagnvqldv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yisA (A:)
    asedkfesvlstrycknsplvsilsetnkatlwrqlwiwlaeaekelglkqvtqdaidem
    ksnrdvfdwpfirseerklkhdvmahnhafgklcptaagiihlgatscfvqdnadliayr
    dsidhilkrfatvidrlaafslknkevvtvgrthyqtaslvtvgkrgvlwaqellmafqs
    lsefrdkmrfrgikgatgtqdsfltlfagdeskvealdelvtkkanfsnrflitgqtysr
    qqdsqlvfslsllgaaakkvctdirvlqafgellepkknpmkserccalsrklinapqea
    ltiladqglertlddsagrrmlipdvlltaeallttlqnifeglsvqtdnvkkivedeia
    flglekammmlqtmadpffdsvrdrvvglvnnpinftgrcvsqtesfiakelkptidkyl
    d