PDB entry 1yir

View 1yir on RCSB PDB site
Description: Crystal Structure of a Nicotinate Phosphoribosyltransferase
Class: transferase
Keywords: Structural genomics, Protein structure initiative, Hypothetical protein, NYSGXRC, T1804, PSI, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2005-01-12, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate phosphoribosyltransferase 2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pncB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW26 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1yira1, d1yira2, d1yira3
  • Chain 'B':
    Compound: Nicotinate phosphoribosyltransferase 2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pncB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW26 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1yirb1, d1yirb2, d1yirb3
  • Chain 'C':
    Compound: Nicotinate phosphoribosyltransferase 2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pncB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW26 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1yirc1, d1yirc2, d1yirc3
  • Chain 'D':
    Compound: Nicotinate phosphoribosyltransferase 2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pncB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW26 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1yird1, d1yird2, d1yird3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yirA (A:)
    mslaesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaire
    qleylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwl
    hvilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgt
    rrrfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprli
    dsqsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaekt
    iahylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmni
    vvkmsacnghpvakisdtpgkaqcrdpdfihylkhvfqvaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yirA (A:)
    laesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaireql
    eylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwlhv
    ilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgtrr
    rfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprlids
    qsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaektia
    hylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmnivv
    kmsacnghpvakisdtppdfihylkhvfqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yirB (B:)
    mslaesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaire
    qleylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwl
    hvilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgt
    rrrfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprli
    dsqsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaekt
    iahylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmni
    vvkmsacnghpvakisdtpgkaqcrdpdfihylkhvfqvaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yirB (B:)
    laesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaireql
    eylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwlhv
    ilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgtrr
    rfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprlids
    qsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaektia
    hylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmnivv
    kmsacnghpvakisdtppdfihylkhvfqv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yirC (C:)
    mslaesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaire
    qleylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwl
    hvilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgt
    rrrfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprli
    dsqsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaekt
    iahylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmni
    vvkmsacnghpvakisdtpgkaqcrdpdfihylkhvfqvaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yirC (C:)
    laesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaireql
    eylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwlhv
    ilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgtrr
    rfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprlids
    qsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaektia
    hylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmnivv
    kmsacnghpvakisdtppdfihylkhvfqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yirD (D:)
    mslaesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaire
    qleylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwl
    hvilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgt
    rrrfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprli
    dsqsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaekt
    iahylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmni
    vvkmsacnghpvakisdtpgkaqcrdpdfihylkhvfqvaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yirD (D:)
    laesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaireql
    eylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwlhv
    ilfevpllamisevrnrarypaatveqarerlqekfdwlrreasaeelagfkmadfgtrr
    rfsyrvheavvsglkedfpgcfvgtsnvhlarkldlkplgtmahewlmahqqlgprlids
    qsaaldcwvreyrgllgialtdcittdaflrdfdlyfaklfdglrhdsgdpllwaektia
    hylklgidpltktlvfsdgldlpralkiyralqgrinvsfgigthftcdlpgvepmnivv
    kmsacnghpvakisdtppdfihylkhvfqv