PDB entry 1yiq

View 1yiq on RCSB PDB site
Description: molecular cloning and structural analysis of quinohemoprotein alcohol dehydrogenase adhiig from pseudomonas putida hk5. compariison to the other quinohemoprotein alcohol dehydrogenase adhiib found in the same microorganism.
Deposited on 2005-01-12, released 2005-08-16
The last revision was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinohemoprotein alcohol dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, PQQ, HEC, PGR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yiqA (A:)
    adipanvdgariiaadkepgnwmstgrtydeqrysplkqisdqnvgqlglawsykldldr
    gveatpivvdgvmyttgpfsvvyaldardgrliwkydpqsdrhrageaccdavnrgvavw
    kgkvyvgvldgrleaidaktgqrawsvdtradhkrsytitgaprvvngkvvignggaefg
    vrgyvtaydaetgkeawrfytvpgdpklppegkgmeiaaktwfgdayveqggggtawdsf
    aydpelnllyigvgngslwdpkwrsqakgdnlflssivavnadtgeyvwhyqttpgdawd
    ytatqhmilaelpidgkprkvlmqapkngffyvidratgellsakgivpqswtkgmdmkt
    grpildeenaaywkngkrnlvtpafwgahdwqpmsynpdtglvyipahimsayyehipea
    pkrnpfksmyqlglrtgmmpegaegllemakswsgkliawdpvkqqaawevpyvtifngg
    tlstagnlvfegsadgrviayaadtgeklweqpaasgvmaapvtysvdgeqyvtfmagwg
    gafstfagalslragvqpyaqvltyklggtaklqepaprpdtpkppalsndtasieagak
    lydgycsqchgihavsggvlpdlrkltpekhqmflgilfggrvpdgmpsfadaftpeqvd
    qihqylikrahdlhqegdtwkqfsakssh
    

    Sequence, based on observed residues (ATOM records):
    >1yiqA (A:)
    adipanvdgariiaadkepgnwmstgrtydeqrysplkqisdqnvgqlglawsykldldr
    gveatpivvdgvmyttgpfsvvyaldardgrliwkydpqsdrhrageaccdavnrgvavw
    kgkvyvgvldgrleaidaktgqrawsvdtradhkrsytitgaprvvngkvvignggaefg
    vrgyvtaydaetgkeawrfytvpgdpklppegkgmeiaaktwfgdayveqggggtawdsf
    aydpelnllyigvgngslwdpkwrsqakgdnlflssivavnadtgeyvwhyqttpgdawd
    ytatqhmilaelpidgkprkvlmqapkngffyvidratgellsakgivpqswtkgmdmkt
    grpildeenaaywkngkrnlvtpafwgahdwqpmsynpdtglvyipahimsayyehipea
    pkrnpfksmyqlglrtgmmpegaegllemakswsgkliawdpvkqqaawevpyvtifngg
    tlstagnlvfegsadgrviayaadtgeklweqpaasgvmaapvtysvdgeqyvtfmagwg
    gafstfagalslragvqpyaqvltyklggtaklqepaprpdtpkppalsndtasieagak
    lydgycsqchgihavsggvlpdlrkltpekhqmflgilfggrvpdgmpsfadaftpeqvd
    qihqylikrahdlhqegdtwkqfs