PDB entry 1yin

View 1yin on RCSB PDB site
Description: Human estrogen receptor alpha ligand-binding domain in complex with compound 3F
Class: hormone/growth factor receptor
Keywords: nuclear receptor, transcription factor, er-alpha, antagonist, hormone-growth factor receptor complex
Deposited on 2005-01-12, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yina_
  • Heterogens: CM3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yinA (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
    hrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yinA (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmvvplydlllemldahrlh
    a