PDB entry 1yii

View 1yii on RCSB PDB site
Description: Crystal Structures of Chicken Annexin V in Complex with Ca2+
Class: protein and metal binding protein
Keywords: Annexin; membrane binding; matrix vessicle, PROTEIN AND METAL BINDING PROTEIN
Deposited on 2005-01-11, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.194
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Annexin A5
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yiia_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yiiA (A:)
    akytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktlf
    grdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpae
    vqnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrvdealvekdaqvlfr
    agelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllavv
    kcirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmiq
    kdtsgdyrkallllcggdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yiiA (A:)
    akytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktlf
    grdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpae
    vqnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrvdealvekdaqvlfr
    agelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllavv
    kcirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmiq
    kdtsgdyrkallllcg