PDB entry 1yig

View 1yig on RCSB PDB site
Description: Crystal Structure of the Human EB1 C-terminal Dimerization Domain
Class: structural protein
Keywords: coiled coil; four helix bundle, STRUCTURAL PROTEIN
Deposited on 2005-01-11, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15691 (Start-75)
      • modified residue (17)
      • engineered (63)
    Domains in SCOPe 2.07: d1yiga1
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15691
      • modified residue (17)
      • engineered (63)
    Domains in SCOPe 2.07: d1yigb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yigA (A:)
    gplgsgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvl
    qrimdilyatdegfvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yigA (A:)
    ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
    degfvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yigB (B:)
    gplgsgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvl
    qrimdilyatdegfvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yigB (B:)
    ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
    d