PDB entry 1yic

View 1yic on RCSB PDB site
Description: the oxidized saccharomyces cerevisiae iso-1-cytochrome c, nmr, 20 structures
Deposited on 1997-02-18, released 1997-07-23
The last revision prior to the SCOP 1.57 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1yic__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1yic_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpxkyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yic_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkyipgtkmafgglkkekdrndlitylkkase