PDB entry 1yib

View 1yib on RCSB PDB site
Description: Crystal Structure of the Human EB1 C-terminal Dimerization Domain
Class: structural protein
Keywords: coiled coil; four helix bundle
Deposited on 2005-01-11, released 2005-03-08
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.221
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: HOMO SAPIENS
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yiba1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yibA (A:)
gplgsgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvl
qrivdilyatdegfvi

    Sequence, based on observed residues (ATOM records): (download) 
    >1yibA (A:)
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat
d