PDB entry 1yib

View 1yib on RCSB PDB site
Description: Crystal Structure of the Human EB1 C-terminal Dimerization Domain
Class: structural protein
Keywords: coiled coil; four helix bundle, STRUCTURAL PROTEIN
Deposited on 2005-01-11, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.221
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15691
  Domains in SCOPe 2.08: d1yiba1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1yibA (A:)
  gplgsgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvl
  qrivdilyatdegfvi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1yibA (A:)
  ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat
  d