PDB entry 1yia

View 1yia on RCSB PDB site
Description: crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with 5-hydroxy tryptophan.
Deposited on 2005-01-11, released 2005-02-22
The last revision was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR1093
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR1093
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Tryptophanyl-tRNA synthetase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR1093
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HRP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yiaA (A:)
    mpfvdlevptmttptpaatparprvltgdrptgalhlghlagslqnrvrlqdeaelfvll
    advqaltdhfdrpeqvrenvlavaldylaagldpqkttcvvqsavpelaeltvyflnlvt
    vshlrqnptvkaeiaqkgygervpagffvypvsqaadiaafgatlvpvgddqlpmleqtr
    eivrrfnalyapvlaepqaqlsrvprlpgldgqakmskslgnaialgdsadevarkvmgm
    ytdpghlrasdpgrvegnpvftfldafdpdparvqalkdqyragglgdvkvkkhlidvln
    gvlapirtrraeyerdpdavlrfvtegtargrevaaqtlgqvrramrlfgh
    

    Sequence, based on observed residues (ATOM records):
    >1yiaA (A:)
    arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
    lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
    ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
    lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
    ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
    lrfvtegtargrevaaqtlgqvrramrlfgh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yiaB (B:)
    mpfvdlevptmttptpaatparprvltgdrptgalhlghlagslqnrvrlqdeaelfvll
    advqaltdhfdrpeqvrenvlavaldylaagldpqkttcvvqsavpelaeltvyflnlvt
    vshlrqnptvkaeiaqkgygervpagffvypvsqaadiaafgatlvpvgddqlpmleqtr
    eivrrfnalyapvlaepqaqlsrvprlpgldgqakmskslgnaialgdsadevarkvmgm
    ytdpghlrasdpgrvegnpvftfldafdpdparvqalkdqyragglgdvkvkkhlidvln
    gvlapirtrraeyerdpdavlrfvtegtargrevaaqtlgqvrramrlfgh
    

    Sequence, based on observed residues (ATOM records):
    >1yiaB (B:)
    arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
    lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
    ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
    lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
    ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
    lrfvtegtargrevaaqtlgqvrramrlfgh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yiaC (C:)
    mpfvdlevptmttptpaatparprvltgdrptgalhlghlagslqnrvrlqdeaelfvll
    advqaltdhfdrpeqvrenvlavaldylaagldpqkttcvvqsavpelaeltvyflnlvt
    vshlrqnptvkaeiaqkgygervpagffvypvsqaadiaafgatlvpvgddqlpmleqtr
    eivrrfnalyapvlaepqaqlsrvprlpgldgqakmskslgnaialgdsadevarkvmgm
    ytdpghlrasdpgrvegnpvftfldafdpdparvqalkdqyragglgdvkvkkhlidvln
    gvlapirtrraeyerdpdavlrfvtegtargrevaaqtlgqvrramrlfgh
    

    Sequence, based on observed residues (ATOM records):
    >1yiaC (C:)
    arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
    lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
    ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
    lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
    ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
    lrfvtegtargrevaaqtlgqvrramrlfgh