PDB entry 1yi9

View 1yi9 on RCSB PDB site
Description: Crystal Structure Analysis of the oxidized form of the M314I mutant of Peptidylglycine alpha-Hydroxylating Monooxygenase
Class: oxidoreductase
Keywords: monooxygenase, bioactive peptide activation, ascorbate, oxidoreductase
Deposited on 2005-01-11, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14925 (0-308)
      • engineered (267)
    Domains in SCOPe 2.07: d1yi9a1, d1yi9a2
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yi9A (A:)
    clgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtv
    hhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsky
    fvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadis
    cqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfg
    dilaarcvftgegrteathiggtssdeicnlyimyymeakyalsfmtctknvapdmfrti
    paeanipip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi9A (A:)
    clgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtv
    hhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsky
    fvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadis
    cqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfg
    dilaarcvftgeeicnlyimyymeakyalsfmtctknvapdmfrtipaeanipip