PDB entry 1yi6

View 1yi6 on RCSB PDB site
Description: C-term tail segment of human tyrosine kinase (258-533)
Class: transferase
Keywords: src, tyrosine kinase, phosphorylation, regulation, sh2, sh3
Deposited on 2005-01-11, released 2006-05-02
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (0-275)
      • modified residue (77)
      • modified residue (158)
    Domains in SCOP 1.73: d1yi6a1
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (0-275)
      • modified residue (77)
      • modified residue (158)
    Domains in SCOP 1.73: d1yi6b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yi6A (A:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
    rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
    cwrkepeerptfeylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yi6B (B:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
    rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
    cwrkepeerptfeylqafledyftstepqyqpgenl