PDB entry 1yhv

View 1yhv on RCSB PDB site
Description: Crystal Structure of PAK1 kinase domain with two point mutations (K299R, T423E)
Class: signaling protein, transferase
Keywords: kinase; active conformation; activation loop; ATP binding site, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2005-01-10, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PAK 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13153 (0-End)
      • engineered (50)
      • engineered (174)
    Domains in SCOPe 2.07: d1yhva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhvA (A:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrsemvgtp
    ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
    klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatknnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhvA (A:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrsemvgtp
    ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
    klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeat