PDB entry 1yhu

View 1yhu on RCSB PDB site
Description: Crystal structure of Riftia pachyptila C1 hemoglobin reveals novel assembly of 24 subunits.
Class: oxygen storage/transport
Keywords: hemoglobin, globin fold, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2005-01-10, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.243
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin A1 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK4 (13-127)
      • see remark 999 (0-12)
      • see remark 999 (128-144)
    Domains in SCOPe 2.08: d1yhua_
  • Chain 'B':
    Compound: Giant hemoglobins B chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhub_
  • Chain 'C':
    Compound: hemoglobin B1a chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK2 (15-132)
      • see remark 999 (0-14)
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21-22)
      • see remark 999 (26)
      • see remark 999 (28-29)
      • see remark 999 (31)
      • see remark 999 (33-34)
      • see remark 999 (38)
      • see remark 999 (57)
      • see remark 999 (64)
      • see remark 999 (68)
      • see remark 999 (80)
      • see remark 999 (106)
      • see remark 999 (110-111)
      • see remark 999 (118)
      • see remark 999 (120)
      • see remark 999 (133-147)
  • Chain 'D':
    Compound: hemoglobin B2 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFJ9 (15-131)
      • see remark 999 (0-14)
      • see remark 999 (132-148)
    Domains in SCOPe 2.08: d1yhud_
  • Chain 'E':
    Compound: hemoglobin A1 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK4 (13-127)
      • see remark 999 (0-12)
      • see remark 999 (128-144)
    Domains in SCOPe 2.08: d1yhue_
  • Chain 'F':
    Compound: Giant hemoglobins B chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhuf_
  • Chain 'G':
    Compound: hemoglobin B1a chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK2 (15-132)
      • see remark 999 (0-14)
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21-22)
      • see remark 999 (26)
      • see remark 999 (28-29)
      • see remark 999 (31)
      • see remark 999 (33-34)
      • see remark 999 (38)
      • see remark 999 (57)
      • see remark 999 (64)
      • see remark 999 (68)
      • see remark 999 (80)
      • see remark 999 (106)
      • see remark 999 (110-111)
      • see remark 999 (118)
      • see remark 999 (120)
      • see remark 999 (133-147)
  • Chain 'H':
    Compound: hemoglobin B2 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFJ9 (15-131)
      • see remark 999 (0-14)
      • see remark 999 (132-148)
    Domains in SCOPe 2.08: d1yhuh_
  • Chain 'I':
    Compound: hemoglobin A1 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK4 (13-127)
      • see remark 999 (0-12)
      • see remark 999 (128-144)
    Domains in SCOPe 2.08: d1yhui_
  • Chain 'J':
    Compound: Giant hemoglobins B chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhuj_
  • Chain 'K':
    Compound: hemoglobin B1a chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK2 (15-132)
      • see remark 999 (0-14)
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21-22)
      • see remark 999 (26)
      • see remark 999 (28-29)
      • see remark 999 (31)
      • see remark 999 (33-34)
      • see remark 999 (38)
      • see remark 999 (57)
      • see remark 999 (64)
      • see remark 999 (68)
      • see remark 999 (80)
      • see remark 999 (106)
      • see remark 999 (110-111)
      • see remark 999 (118)
      • see remark 999 (120)
      • see remark 999 (133-147)
  • Chain 'L':
    Compound: hemoglobin B2 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFJ9 (15-131)
      • see remark 999 (0-14)
      • see remark 999 (132-148)
    Domains in SCOPe 2.08: d1yhul_
  • Chain 'M':
    Compound: hemoglobin A1 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK4 (13-127)
      • see remark 999 (0-12)
      • see remark 999 (128-144)
    Domains in SCOPe 2.08: d1yhum_
  • Chain 'N':
    Compound: Giant hemoglobins B chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhun_
  • Chain 'O':
    Compound: hemoglobin B1a chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK2 (15-132)
      • see remark 999 (0-14)
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21-22)
      • see remark 999 (26)
      • see remark 999 (28-29)
      • see remark 999 (31)
      • see remark 999 (33-34)
      • see remark 999 (38)
      • see remark 999 (57)
      • see remark 999 (64)
      • see remark 999 (68)
      • see remark 999 (80)
      • see remark 999 (106)
      • see remark 999 (110-111)
      • see remark 999 (118)
      • see remark 999 (120)
      • see remark 999 (133-147)
  • Chain 'P':
    Compound: hemoglobin B2 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFJ9 (15-131)
      • see remark 999 (0-14)
      • see remark 999 (132-148)
    Domains in SCOPe 2.08: d1yhup_
  • Chain 'Q':
    Compound: hemoglobin A1 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK4 (13-127)
      • see remark 999 (0-12)
      • see remark 999 (128-144)
    Domains in SCOPe 2.08: d1yhuq_
  • Chain 'R':
    Compound: Giant hemoglobins B chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhur_
  • Chain 'S':
    Compound: hemoglobin B1a chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK2 (15-132)
      • see remark 999 (0-14)
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21-22)
      • see remark 999 (26)
      • see remark 999 (28-29)
      • see remark 999 (31)
      • see remark 999 (33-34)
      • see remark 999 (38)
      • see remark 999 (57)
      • see remark 999 (64)
      • see remark 999 (68)
      • see remark 999 (80)
      • see remark 999 (106)
      • see remark 999 (110-111)
      • see remark 999 (118)
      • see remark 999 (120)
      • see remark 999 (133-147)
  • Chain 'T':
    Compound: hemoglobin B2 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFJ9 (15-131)
      • see remark 999 (0-14)
      • see remark 999 (132-148)
    Domains in SCOPe 2.08: d1yhut_
  • Chain 'U':
    Compound: hemoglobin A1 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK4 (13-127)
      • see remark 999 (0-12)
      • see remark 999 (128-144)
    Domains in SCOPe 2.08: d1yhuu_
  • Chain 'V':
    Compound: Giant hemoglobins B chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhuv_
  • Chain 'W':
    Compound: hemoglobin B1a chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFK2 (15-132)
      • see remark 999 (0-14)
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21-22)
      • see remark 999 (26)
      • see remark 999 (28-29)
      • see remark 999 (31)
      • see remark 999 (33-34)
      • see remark 999 (38)
      • see remark 999 (57)
      • see remark 999 (64)
      • see remark 999 (68)
      • see remark 999 (80)
      • see remark 999 (106)
      • see remark 999 (110-111)
      • see remark 999 (118)
      • see remark 999 (120)
      • see remark 999 (133-147)
  • Chain 'X':
    Compound: hemoglobin B2 chain
    Species: Riftia pachyptila [TaxId:6426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IFJ9 (15-131)
      • see remark 999 (0-14)
      • see remark 999 (132-148)
    Domains in SCOPe 2.08: d1yhux_
  • Heterogens: ZN, HEM, OXY

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuA (A:)
    acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
    ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
    vcfdvpawqgcyniiakgitgsdaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuB (B:)
    dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
    frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
    igsevfdqdawkpclnvitngiqg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuD (D:)
    aascttedrremqlmwgnvwsaqftgrriaiaqavfkdlfanvpdavglfgavkgdevns
    nefkahcirvvngldssigllsdpatlneqlshlatqhkarsgvtkggfsaiaqsflrvm
    pqvascfnpdawsrcfnrittgmteplpa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuE (E:)
    acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
    ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
    vcfdvpawqgcyniiakgitgsdaa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuF (F:)
    dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
    frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
    igsevfdqdawkpclnvitngiqg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuH (H:)
    aascttedrremqlmwgnvwsaqftgrriaiaqavfkdlfanvpdavglfgavkgdevns
    nefkahcirvvngldssigllsdpatlneqlshlatqhkarsgvtkggfsaiaqsflrvm
    pqvascfnpdawsrcfnrittgmteplpa
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuI (I:)
    acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
    ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
    vcfdvpawqgcyniiakgitgsdaa
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuJ (J:)
    dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
    frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
    igsevfdqdawkpclnvitngiqg
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuL (L:)
    aascttedrremqlmwgnvwsaqftgrriaiaqavfkdlfanvpdavglfgavkgdevns
    nefkahcirvvngldssigllsdpatlneqlshlatqhkarsgvtkggfsaiaqsflrvm
    pqvascfnpdawsrcfnrittgmteplpa
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuM (M:)
    acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
    ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
    vcfdvpawqgcyniiakgitgsdaa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuN (N:)
    dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
    frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
    igsevfdqdawkpclnvitngiqg
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuP (P:)
    aascttedrremqlmwgnvwsaqftgrriaiaqavfkdlfanvpdavglfgavkgdevns
    nefkahcirvvngldssigllsdpatlneqlshlatqhkarsgvtkggfsaiaqsflrvm
    pqvascfnpdawsrcfnrittgmteplpa
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuQ (Q:)
    acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
    ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
    vcfdvpawqgcyniiakgitgsdaa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuR (R:)
    dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
    frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
    igsevfdqdawkpclnvitngiqg
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuT (T:)
    aascttedrremqlmwgnvwsaqftgrriaiaqavfkdlfanvpdavglfgavkgdevns
    nefkahcirvvngldssigllsdpatlneqlshlatqhkarsgvtkggfsaiaqsflrvm
    pqvascfnpdawsrcfnrittgmteplpa
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuU (U:)
    acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
    ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
    vcfdvpawqgcyniiakgitgsdaa
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuV (V:)
    dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
    frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
    igsevfdqdawkpclnvitngiqg
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhuX (X:)
    aascttedrremqlmwgnvwsaqftgrriaiaqavfkdlfanvpdavglfgavkgdevns
    nefkahcirvvngldssigllsdpatlneqlshlatqhkarsgvtkggfsaiaqsflrvm
    pqvascfnpdawsrcfnrittgmteplpa