PDB entry 1yht

View 1yht on RCSB PDB site
Description: Crystal structure analysis of Dispersin B
Class: hydrolase
Keywords: beta barrel, HYDROLASE
Deposited on 2005-01-10, released 2006-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.154
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DspB
    Species: Aggregatibacter actinomycetemcomitans [TaxId:714]
    Gene: dspB
    Database cross-references and differences (RAF-indexed):
    • GB AAP31025
    Domains in SCOPe 2.06: d1yhta1
  • Heterogens: ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhtA (A:)
    nccvkgnsiypqktstkqtglmldiarhfyspeviksfidtislsggnflhlhfsdheny
    aieshllnqraenavqgkdgiyinpytgkpflsyrqlddikayakakgielipeldspnh
    mtaifklvqkdrgvkylqglksrqvddeiditnadsitfmqslmsevidifgdtsqhfhi
    ggdefgysvesnhefityanklsyflekkglktrmwndglikntfeqinpnieitywsyd
    gdtqdkneaaerrdmrvslpellakgftvlnynsyylyivpkasptfsqdaafaakdvik
    nwdlgvwdgrntknrvqntheiagaalsiwgedakalkdetiqkntkslleavihktngd
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhtA (A:)
    tkqtglmldiarhfyspeviksfidtislsggnflhlhfsdhenyaieshllnqraenav
    qgkdgiyinpytgkpflsyrqlddikayakakgielipeldspnhmtaifklvqkdrgvk
    ylqglksrqvddeiditnadsitfmqslmsevidifgdtsqhfhiggdefgysvesnhef
    ityanklsyflekkglktrmwndglikntfeqinpnieitywsydgdtqdkneaaerrdm
    rvslpellakgftvlnynsyylyivpkasptfsqdaafaakdviknwdlgvwdgrntknr
    vqntheiagaalsiwgedakalkdetiqkntkslleavihktng