PDB entry 1yhs

View 1yhs on RCSB PDB site
Description: Crystal structure of Pim-1 bound to staurosporine
Class: transferase
Keywords: Protein kinase, Proto-oncogene, TRANSFERASE
Deposited on 2005-01-10, released 2005-01-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11309 (0-272)
      • modified residue (128)
      • modified residue (228)
    Domains in SCOPe 2.05: d1yhsa_
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhsA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhsA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgetrvpmevvllkkv
    ssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavr
    hchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryh
    ryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrps
    drptfeeiqnhpwmqdvllpqetaeihlh