PDB entry 1yhp

View 1yhp on RCSB PDB site
Description: Solution Structure of Ca2+-free DdCAD-1
Deposited on 2005-01-10, released 2006-01-31
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-dependent cell adhesion molecule-1
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: cadA
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yhpA (A:)
    svdankvkfffgknctgesfeynkgetvrfnngdkwndkfmsclvgsnvrcniwehneid
    tptpgkfqelaqgstnndltsinglskfqvlpgafqwavdvkivnkvnstagsyemtitp
    yqvdkvackdgddfvqlpipkltppdseivshltvrqthtpydyvvngsvyfkyspttgq
    vtvikkdetfpknmtvtqddntsfifnlnsek