PDB entry 1yhn

View 1yhn on RCSB PDB site
Description: Structure basis of RILP recruitment by Rab7
Class: Protein transport
Keywords: RILP, Rab7, Protein transport
Deposited on 2005-01-10, released 2005-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.268
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-7
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (66)
    Domains in SCOPe 2.08: d1yhna_
  • Chain 'B':
    Compound: Rab interacting lysosomal protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RILP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yhnb1
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhnA (A:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhnA (A:)
    srkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiw
    dtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvv
    lgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
    yne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhnB (B:)
    sreefeqilqernelkakvfllkeelayfqrelltdhrvpsllleamkvavrkqrkkika
    kmlgt