PDB entry 1yhj

View 1yhj on RCSB PDB site
Description: Crystal Structure of Pyridoxal Kinase in Complex with Roscovitine and Derivatives
Class: transferase
Keywords: Alpha-beta structure, complexed with O6-(R)-roscovitine, TRANSFERASE
Deposited on 2005-01-09, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal kinase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yhja_
  • Heterogens: R6C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhjA (A:)
    meeecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsd
    elqelydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqr
    ngegamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgp
    dtvvitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdi
    espeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhjA (A:)
    rvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelqel
    ydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrngega
    myvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtvvi
    tssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamllawt
    hkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiespei
    vvqatvl