PDB entry 1yhi

View 1yhi on RCSB PDB site
Description: Uncyclized precursor structure of S65A Y66S R96A GFP variant
Class: luminescent protein
Keywords: Chromophore, uncyclized, LUMINESCENT PROTEIN
Deposited on 2005-01-08, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (2-End)
      • engineered (65-66)
      • engineered (96)
      • engineered (99)
      • engineered (153)
      • engineered (163)
    Domains in SCOPe 2.07: d1yhia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhiA (A:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttfasgvqcfsrypdhmkqhdffksampegyvqeatisfkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhiA (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfasgvqcfsrypdhmkqhdffksampegyvqeatisfkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaag