PDB entry 1yhf

View 1yhf on RCSB PDB site
Description: Crystal Structure of Conserved SPY1581 Protein of Unknown Function from Streptococcus pyogenes
Class: structural genomics, unknown function
Keywords: structural genomics, conserved hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-01-07, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SPy1581
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Gene: SPy1581
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YR1 (3-114)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (22)
      • modified residue (28)
      • modified residue (62)
      • modified residue (89)
      • modified residue (105)
    Domains in SCOPe 2.08: d1yhfa1, d1yhfa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhfA (A:)
    snamsyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspg
    damvtilsglaeitidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhfA (A:)
    namsyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspgd
    amvtilsglaeitidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea