PDB entry 1yhb

View 1yhb on RCSB PDB site
Description: crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssDNA complex
Class: DNA binding protein
Keywords: DNA-binding protein, DNA binding protein
Deposited on 1994-04-14, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene v protein
    Species: Enterobacteria phage M13 [TaxId:10863]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69543 (0-86)
      • conflict (40)
    Domains in SCOPe 2.08: d1yhba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhbA (A:)
    mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnefpvlvkitldegqpayapgl
    ytvhlssfkvgqfgslmidrlrlvpak