PDB entry 1yh6

View 1yh6 on RCSB PDB site
Description: Human ubiquitin-conjugating enzyme E2 H
Class: ligase
Keywords: structural genomics consortium, ubiquitin, ubiquitin-conjugating enzyme, ube2h, sgc, ligase
Deposited on 2005-01-07, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-10-09, with a file datestamp of 2007-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 H
    Species: HOMO SAPIENS
    Gene: UBE2H
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yh6a_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 H
    Species: HOMO SAPIENS
    Gene: UBE2H
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yh6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yh6A (A:)
    mgsshhhhhhssglvprgsmsspspgkrrmdtdvvklieskhevtilgglnefvvkfygp
    qgtpyeggvwkvrvdlpdkypfkspsigfmnkifhpnideasgtvcldvinqtwtalydl
    tnifesflpqllaypnpidplngdaaamylhrpeeykqkikeyiqkyateealkeqeeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yh6A (A:)
    pspgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
    kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
    gdaaamylhrpeeykqkikeyiqkyateealk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yh6B (B:)
    mgsshhhhhhssglvprgsmsspspgkrrmdtdvvklieskhevtilgglnefvvkfygp
    qgtpyeggvwkvrvdlpdkypfkspsigfmnkifhpnideasgtvcldvinqtwtalydl
    tnifesflpqllaypnpidplngdaaamylhrpeeykqkikeyiqkyateealkeqeeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yh6B (B:)
    pgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks
    psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd
    aaamylhrpeeykqkikeyiqkyateealk