PDB entry 1yh5

View 1yh5 on RCSB PDB site
Description: Solution NMR Structure of Protein yggU from Escherichia coli. Northeast Structural Genomics Consortium Target ER14.
Class: structural genomics, unknown function
Keywords: ALPHA+BETA; NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, PSI, Protein Structure Initiative, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-01-06, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf, hypothetical protein
    Species: Escherichia coli [TaxId:155864]
    Gene: yggU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XCU6 (0-99)
      • expression tag (100-107)
    Domains in SCOPe 2.07: d1yh5a2, d1yh5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yh5A (A:)
    mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflg
    kqfrvaksqvviekgelgrhkqikiinpqqippevaalinlehhhhhh