PDB entry 1yh2

View 1yh2 on RCSB PDB site
Description: Ubiquitin-Conjugating Enzyme HSPC150
Class: ligase
Keywords: structural genomics consortium, hscp150, ubiquitin, ubiquitin-conjugating enzyme, ligase, sgc
Deposited on 2005-01-06, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HSPC150 protein similar to ubiquitin-conjugating enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC150
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPD8 (0-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1yh2a1, d1yh2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yh2A (A:)
    gsmqrasrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviip
    erypfeppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsep
    npddplmadissefkynkpaflknarqwtekharqkqkadeeemldnlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yh2A (A:)
    gsmqrasrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviip
    erypfeppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsep
    npddplmadissefkynkpaflknarqwtekharqk