PDB entry 1yh0

View 1yh0 on RCSB PDB site
Description: Crystal Structure of Acetylornithine Transcarbamylase
Deposited on 2005-01-06, released 2005-03-01
The last revision was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetyl-L-ornithine carbamoyltransferase
    Species: Xanthomonas campestris [TaxId:339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8P8J2
      • expression tag (24)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yh0A (A:)
    mgsshhhhhhssglvprgshmslkhflntqdwsraeldalltqaalfkrnklgselkgks
    ialvffnpsmrtrtsfelgafqlgghavvlqpgkdawpiefnlgtvmdgdteehiaevar
    vlgryvdligvrafpkfvdwskdredqvlksfakyspvpvinmetithpcqelahalalq
    ehfgtpdlrgkkyvltwtyhpkplntavansaltiatrmgmdvtllcptpdyilderymd
    waaqnvaesggslqvshdidsayagadvvyakswgalpffgnwepekpirdqyqhfivde
    rkmaltnngvfshclplrrnvkatdavmdspnciaideaenrlhvqkaimaalvgqsrp
    

    Sequence, based on observed residues (ATOM records):
    >1yh0A (A:)
    lkhflntqdwsraeldalltqaalfkrnklgselkgksialvffnpsmrtrtsfelgafq
    lgghavvlqpgpiefnlgtvmdgdteehiaevarvlgryvdligvrafpkfvdwskdred
    qvlksfakyspvpvinmetithpcqelahalalqehfgtpdlrgkkyvltwtyhpkplnt
    avansaltiatrmgmdvtllcptpdyilderymdwaaqnvaesggslqvshdidsayaga
    dvvyakswgalpffgnwepekpirdqyqhfivderkmaltnngvfshclplrrnvkatda
    vmdspnciaideaenrlhvqkaimaalv