PDB entry 1ygw

View 1ygw on RCSB PDB site
Description: nmr structure of ribonuclease t1, 34 structures
Deposited on 1996-09-28, released 1997-10-08
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-08, with a file datestamp of 1997-10-08.
Experiment type: NMR34
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ygw__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ygw_ (-)
    acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect