PDB entry 1ygw

View 1ygw on RCSB PDB site
Description: nmr structure of ribonuclease t1, 34 structures
Class: hydrolase
Keywords: hydrolase, ribonuclease, endonuclease, ribonuclease t1 precursor, endoribonuclease
Deposited on 1996-09-28, released 1997-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: RIBONUCLEASE T1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ygwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ygwA (A:)
    acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect