PDB entry 1ygv

View 1ygv on RCSB PDB site
Description: The structure of collagen type I. Single type I collagen molecule: rigid refinment
Deposited on 2005-01-05, released 2006-05-16
The last revision was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: FIBER
Resolution: 5.16 Å
R-factor: 0.107
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen I alpha 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02454 (1-1045)
      • conflict (10)
      • conflict (12)
      • conflict (50)
      • conflict (57)
      • conflict (117)
      • conflict (134)
      • conflict (152)
      • conflict (155)
      • conflict (165)
      • conflict (186)
      • conflict (195)
      • conflict (258)
      • conflict (269)
      • conflict (345)
      • conflict (398)
      • conflict (425)
      • conflict (458)
      • conflict (525)
      • conflict (536)
      • conflict (549)
      • conflict (593)
      • conflict (642)
      • conflict (669)
      • conflict (671)
      • conflict (701)
      • conflict (704)
      • conflict (738)
      • conflict (743)
      • conflict (773)
      • conflict (782)
      • conflict (806)
      • conflict (854)
      • conflict (866)
      • conflict (900)
      • conflict (912)
      • conflict (915)
      • conflict (939)
      • conflict (959)
      • conflict (1011)
      • conflict (1035)
      • conflict (1044)
  • Chain 'B':
    Compound: collagen I alpha 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02466 (7-1017)
      • conflict (23)
      • conflict (35)
      • conflict (49)
      • conflict (53)
      • conflict (77)
      • conflict (107)
      • conflict (113)
      • conflict (131)
      • conflict (203)
      • conflict (218)
      • conflict (220)
      • conflict (224)
      • conflict (230)
      • conflict (259)
      • conflict (275)
      • conflict (283-284)
      • conflict (286-287)
      • conflict (302)
      • conflict (305)
      • conflict (307)
      • conflict (311)
      • conflict (319)
      • conflict (331)
      • conflict (338)
      • conflict (340)
      • conflict (343-344)
      • conflict (356)
      • conflict (370)
      • conflict (377)
      • conflict (409)
      • conflict (419)
      • conflict (421)
      • conflict (430-431)
      • conflict (454)
      • conflict (460)
      • conflict (479)
      • conflict (481)
      • conflict (485)
      • conflict (494)
      • conflict (505)
      • conflict (515)
      • conflict (521)
      • conflict (526)
      • conflict (532)
      • conflict (559)
      • conflict (565)
      • conflict (568)
      • conflict (577-578)
      • conflict (583-584)
      • conflict (586-587)
      • conflict (595)
      • conflict (607-608)
      • conflict (614)
      • conflict (616)
      • conflict (620)
      • conflict (625)
      • conflict (628-629)
      • conflict (635)
      • conflict (638)
      • conflict (641)
      • conflict (649)
      • conflict (659)
      • conflict (665)
      • conflict (668)
      • conflict (670)
      • conflict (674)
      • conflict (683)
      • conflict (686)
      • conflict (688-689)
      • conflict (694)
      • conflict (698)
      • conflict (701)
      • conflict (721)
      • conflict (749)
      • conflict (752)
      • conflict (755)
      • conflict (758)
      • conflict (761)
      • conflict (767)
      • conflict (772-773)
      • conflict (778-779)
      • conflict (790)
      • conflict (802)
      • conflict (805)
      • conflict (808-809)
      • conflict (829)
      • conflict (832)
      • conflict (850)
      • conflict (868)
      • conflict (872)
      • conflict (875)
      • conflict (878)
      • conflict (881)
      • conflict (883)
      • conflict (886-887)
      • conflict (890)
      • conflict (901)
      • conflict (905)
      • conflict (923)
      • conflict (931-932)
      • conflict (934-935)
      • conflict (937-938)
      • conflict (952)
      • conflict (961)
      • conflict (977)
      • conflict (980)
      • conflict (983)
      • conflict (985-986)
      • conflict (989)
      • conflict (991)
      • conflict (994)
  • Chain 'C':
    Compound: collagen I alpha 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02454 (1-1045)
      • conflict (10)
      • conflict (12)
      • conflict (50)
      • conflict (57)
      • conflict (117)
      • conflict (134)
      • conflict (152)
      • conflict (155)
      • conflict (165)
      • conflict (186)
      • conflict (195)
      • conflict (258)
      • conflict (269)
      • conflict (345)
      • conflict (398)
      • conflict (425)
      • conflict (458)
      • conflict (525)
      • conflict (536)
      • conflict (549)
      • conflict (593)
      • conflict (642)
      • conflict (669)
      • conflict (671)
      • conflict (701)
      • conflict (704)
      • conflict (738)
      • conflict (743)
      • conflict (773)
      • conflict (782)
      • conflict (806)
      • conflict (854)
      • conflict (866)
      • conflict (900)
      • conflict (912)
      • conflict (915)
      • conflict (939)
      • conflict (959)
      • conflict (1011)
      • conflict (1035)
      • conflict (1044)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ygvA (A:)
    emsygydekstgisvpgpmgpsgprglpgppgapgpqgfqgppgepgepgasgpmgprgp
    pgppgkngddgeagkpgrpgergppgpqgarglpgtaglpgmkghrgfsgldgakgdagp
    agpkgepgspgengapgqmgprglpgergrpgapgpagargndgaagaagppgptgptgp
    pgfpgavgakgeagpegargsegpqgvrgepgppgpagaagpagnpgadgqpgakganga
    pgiagapgfpgargpsgpegpsgapgpkgnsgepgapgnkgdtgakgepgpagvqgppgp
    ageegkrgargepgpsglpgppgerggpgsrgfpgadgvagpkgpagergspgpagpkgs
    pgeagrpgeaglpgakgltgspgspgpdgktgppgpagedgrpgpagppgargqagvmgf
    pgpkgaagepgkagergvpgppgavgpagkdgeagaqgppgpagpagergeqgpagspgf
    qglpgpagppgeagkpgeqgvpgdlgapgpsgargergfpgergvegppgpagprganga
    pgndgakgdagapgapgsqgapglqgmpgergaaglpgpkgdrgdagpkgadgapgkdgv
    rgltgpigppgpagapgdkgeagpsgpagptgargapgdrgepgppgpagfagppgadgq
    pgakgepgdagakgdagppgpagpagppgpignvgapgpkgargsagppgatgfpgaagr
    vgppgpsgnagppgppgpagkegskgprgetgpagrpgevgppgppgpagekgapgadgp
    agapgtpgpqgiagqrgvvglpgqrgergfpglpgpsgepgkqgpsgasgergppgpmgp
    pglagppgesgregapgaegspgrdgspgakgdrgetgpagppgapgapgapgpvgpagk
    sgdrgetgpagpigpvgpagargpagpqgprgdkgetgeegdrgikghrgfsglqgppgp
    pgspgeqgpsgasgpagprgppgsagspgkdglnglpgpigppgprgrtgdagpagppgp
    pgppgppgppsggydlsflpqppqqkahdkgryy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1ygvB (B:)
    efdakgggpgpmglmgprgppgasgapgpqgfqgppgepgepgqtgpagargppgppgka
    gedghpgkpgrpgergvpgpqgargfpgtpglpgfkgirghngldgltgqpgapgvkgep
    gapgengtpgqkgarglpgergrvgapgpagargsdgsvgpvgpagpigsagppgfpgap
    gpkgelgpvgnpgpagpagprgevglpglsgpvgppgnagpnglpgakgaaglpgvagap
    glpgprgipgpvgaagatgarglvgepgpagskgesgnkgepgavgqpgppgpsgeegkr
    gstgeigpagppgppglrgnpgsrglpgadgvagvmgpagsrgtsgpagvrgpngdsgrp
    gepglmgprgfpgspgnigpagkegpvglpgidgrpgpigpagprgeagaigfpgpkgpt
    gepgkpgekgnvglagargapgpdgnngaqgppglqgvqgekgeqgpagppgfqglpgpa
    gpageagkpgerglhgefglpgpagargergppgergaagptgpigsrgpsgppgpdgnk
    geagavgpagapgpagppgipgergvagvpggkgekgapglrgdtgatgrdgarglpgai
    gapgpaggagdrgeggpagpagpagargirgergepgpvgpsgfagpagaagqpgakger
    gtkgpvgeqgpvgpqgpvgaagppgpvgaagpagprgdagptgmtgfpgaagrtgppgps
    gltgppgppgaagkegirgprgdqgpvgrsgetgatgptgfvgekgptgepgsagppgpp
    gpqgllgapgflglpgsrgerglpgvagsvgepgplgiagppgargppgnvgnpgvngap
    geagrdgnpgndgppgrdgqpghkgergtpgnagppgavgpvgpvgepgklgnrgepgpa
    gavgpagavgprgpsgpqgirgddgepgdkgdkgikgdrghnglqglpglaghhgdqgap
    gavgpagprgpagpsgpagkigrigavgpagaagirgsqgsqgpagppgppgppgppgpp
    sggyef
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1ygvC (C:)
    emsygydekstgisvpgpmgpsgprglpgppgapgpqgfqgppgepgepgasgpmgprgp
    pgppgkngddgeagkpgrpgergppgpqgarglpgtaglpgmkghrgfsgldgakgdagp
    agpkgepgspgengapgqmgprglpgergrpgapgpagargndgaagaagppgptgptgp
    pgfpgavgakgeagpegargsegpqgvrgepgppgpagaagpagnpgadgqpgakganga
    pgiagapgfpgargpsgpegpsgapgpkgnsgepgapgnkgdtgakgepgpagvqgppgp
    ageegkrgargepgpsglpgppgerggpgsrgfpgadgvagpkgpagergspgpagpkgs
    pgeagrpgeaglpgakgltgspgspgpdgktgppgpagedgrpgpagppgargqagvmgf
    pgpkgaagepgkagergvpgppgavgpagkdgeagaqgppgpagpagergeqgpagspgf
    qglpgpagppgeagkpgeqgvpgdlgapgpsgargergfpgergvegppgpagprganga
    pgndgakgdagapgapgsqgapglqgmpgergaaglpgpkgdrgdagpkgadgapgkdgv
    rgltgpigppgpagapgdkgeagpsgpagptgargapgdrgepgppgpagfagppgadgq
    pgakgepgdagakgdagppgpagpagppgpignvgapgpkgargsagppgatgfpgaagr
    vgppgpsgnagppgppgpagkegskgprgetgpagrpgevgppgppgpagekgapgadgp
    agapgtpgpqgiagqrgvvglpgqrgergfpglpgpsgepgkqgpsgasgergppgpmgp
    pglagppgesgregapgaegspgrdgspgakgdrgetgpagppgapgapgapgpvgpagk
    sgdrgetgpagpigpvgpagargpagpqgprgdkgetgeegdrgikghrgfsglqgppgp
    pgspgeqgpsgasgpagprgppgsagspgkdglnglpgpigppgprgrtgdagpagppgp
    pgppgppgppsggydlsflpqppqqkahdkgryy