PDB entry 1ygu

View 1ygu on RCSB PDB site
Description: Crystal structure of the tandem phosphatase domains of RPTP CD45 with a pTyr peptide
Deposited on 2005-01-05, released 2005-02-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.262
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukocyte common antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRC, CD45
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08575 (0-End)
      • modified residue (4)
      • variant (28)
      • modified residue (115)
      • modified residue (126)
      • modified residue (145)
      • engineered (229)
      • modified residue (245)
      • modified residue (271)
      • modified residue (308)
      • modified residue (400)
      • modified residue (408)
      • modified residue (425)
      • modified residue (436)
      • modified residue (516)
      • variant (585)
      • modified residue (587)
  • Chain 'B':
    Compound: Leukocyte common antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRC, CD45
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08575
      • modified residue (4)
      • variant (28)
      • modified residue (115)
      • modified residue (126)
      • modified residue (145)
      • engineered (229)
      • modified residue (245)
      • modified residue (271)
      • modified residue (308)
      • modified residue (400)
      • modified residue (408)
      • modified residue (425)
      • modified residue (436)
      • modified residue (516)
      • variant (585)
      • modified residue (587)
  • Chain 'C':
    Compound: Polyoma Middle T antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03077 (0-3)
      • modified residue (2)
  • Chain 'D':
    Compound: Polyoma Middle T antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03077 (0-3)
      • modified residue (2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yguA (A:)
    ekqlmnvepihadilletykrkiadegrpflaefqsiprvfskfpikearkpfnqnknry
    vdilpydynrvelseingdagsnyinasyidgfkeprkyiaaqgprdetvddfwrmiweq
    katvivmvtrceegnrnkcaeywpsmeegtrafgdvvvkinqhkrcpdyiiqklnivnkk
    ekatgrevthiqftswpdhgvpedphlllklrrrvnafsnffsgpivvhssagvgrtgty
    igidamlegleaenkvdvygyvvklrrqrclmvqveaqyilihqalveynqfgetevnls
    elhpylhnmkkrdppsepspleaefqrlpsyrswrtqhignqeenksknrnsnvipydyn
    rvplkhelemskesehdsdessdddsdseepskyinasfimsywkpevmiaaqgplketi
    gdfwqmifqrkvkvivmltelkhgdqeicaqywgegkqtygdievdlkdtdksstytlrv
    felrhskrkdsrtvyqyqytnwsveqlpaepkelismiqvvkqklpqknssegnkhhkst
    pllihcrdgsqqtgifcallnllesaeteevvdifqvvkalrkarlgmvstfeqyqflyd
    viastypaqn
    

    Sequence, based on observed residues (ATOM records):
    >1yguA (A:)
    ekqlmnvepihadilletykrkiadegrpflaefqsiprvfskfpikearkpfnqnknry
    vdilpydynrvelseingdagsnyinasyidgfkeprkyiaaqgprdetvddfwrmiweq
    katvivmvtrceegnrnkcaeywpsmeegtrafgdvvvkinqhkrcpdyiiqklnivnkk
    ekatgrevthiqftswpdhgvpedphlllklrrrvnafsnffsgpivvhssagvgrtgty
    igidamlegleaenkvdvygyvvklrrqrclmvqveaqyilihqalveynqfgetevnls
    elhpylhnmkkrdppsepspleaefqrlpsyrswrtqhignqeenksknrnsnvipydyn
    rvplkskyinasfimsywkpevmiaaqgplketigdfwqmifqrkvkvivmltelkhgdq
    eicaqywgegkqtygdievdlkdtdksstytlrvfelrhskrkdsrtvyqyqytnwsveq
    lpaepkelismiqvvkqklpqkntpllihcrdgsqqtgifcallnllesaeteevvdifq
    vvkalrkarlgmvstfeqyqflydviastyp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yguB (B:)
    ekqlmnvepihadilletykrkiadegrpflaefqsiprvfskfpikearkpfnqnknry
    vdilpydynrvelseingdagsnyinasyidgfkeprkyiaaqgprdetvddfwrmiweq
    katvivmvtrceegnrnkcaeywpsmeegtrafgdvvvkinqhkrcpdyiiqklnivnkk
    ekatgrevthiqftswpdhgvpedphlllklrrrvnafsnffsgpivvhssagvgrtgty
    igidamlegleaenkvdvygyvvklrrqrclmvqveaqyilihqalveynqfgetevnls
    elhpylhnmkkrdppsepspleaefqrlpsyrswrtqhignqeenksknrnsnvipydyn
    rvplkhelemskesehdsdessdddsdseepskyinasfimsywkpevmiaaqgplketi
    gdfwqmifqrkvkvivmltelkhgdqeicaqywgegkqtygdievdlkdtdksstytlrv
    felrhskrkdsrtvyqyqytnwsveqlpaepkelismiqvvkqklpqknssegnkhhkst
    pllihcrdgsqqtgifcallnllesaeteevvdifqvvkalrkarlgmvstfeqyqflyd
    viastypaqn
    

    Sequence, based on observed residues (ATOM records):
    >1yguB (B:)
    kqlmnvepihadilletykrkiadegrpflaefqsiprvfskfpikearkpfnqnknryv
    dilpydynrvelseingdagsnyinasyidgfkeprkyiaaqgprdetvddfwrmiweqk
    atvivmvtrceegnrnkcaeywpsmeegtrafgdvvvkinqhkrcpdyiiqklnivnkke
    katgrevthiqftswpdhgvpedphlllklrrrvnafsnffsgpivvhssagvgrtgtyi
    gidamlegleaenkvdvygyvvklrrqrclmvqveaqyilihqalveynqfgetevnlse
    lhpylhnmkkrdppsepspleaefqrlpsyrswrtqhignqeenksknrnsnvipydynr
    vplkheskyinasfimsywkpevmiaaqgplketigdfwqmifqrkvkvivmltelkhgd
    qeicaqywgegkqtygdievdlkdtdksstytlrvfelrhskrkdsrtvyqyqytnwsve
    qlpaepkelismiqvvkqklpqknssegnkhhkstpllihcrdgsqqtgifcallnlles
    aeteevvdifqvvkalrkarlgmvstfeqyqflydviastyp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1yguC (C:)
    ptys
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1yguD (D:)
    ptys